Pertuzumab antibody | AbD35668
![Anti Pertuzumab Antibody, clone AbD35668 thumbnail image 1](https://images.bio-rad-antibodies.com/monoclonal/pertuzumab-antibody-abd35668-hca341-image1-52w.jpg)
![Anti Pertuzumab Antibody, clone AbD35668 thumbnail image 2](https://images.bio-rad-antibodies.com/monoclonal/pertuzumab-antibody-abd35668-hca341-image2-52w.jpg)
![Anti Pertuzumab Antibody, clone AbD35668 thumbnail image 3](https://images.bio-rad-antibodies.com/monoclonal/pertuzumab-antibody-abd35668-hca341-image3-52w.jpg)
![Anti Pertuzumab Antibody, clone AbD35668 thumbnail image 4](https://images.bio-rad-antibodies.com/monoclonal/pertuzumab-antibody-abd35668-hca341-image4-52w.jpg)
Human anti Pertuzumab
- Product Type
- Monoclonal Antibody
- Clone
- AbD35668
- Isotype
- HuCAL Fab monovalent
- Specificity
- Pertuzumab
Human Anti-Pertuzumab Antibody, clone AbD35668 is a paratope specific, inhibitory anti-idiotypic antibody that specifically recognizes the humanized monoclonal antibody pertuzumab. It does not recognize free human epidermal growth factor receptor 2 (HER2) nor pertuzumab in complex with HER2. The antibody can be used to measure pertuzumab or its biosimilars in patient samples. Clone AbD35668 is a fully human recombinant monoclonal antibody in monovalent Fab format and is suitable as the capture antibody in a pharmacokinetic (PK) bridging ELISA. Pertuzumab (Perjeta) is an IgG1/kappa antibody humanized from mouse. It has been approved for the treatment of patients with metastatic HER2-positive breast cancer in combination with trastuzumab. Pertuzumab binds to the extracellular domain II of HER2 and inhibits HER2–HER3 dimerization, reducing signaling through intracellular pathways (Capelan et al. 2013). View a summary of all anti-pertuzumab antibodies |
|
- Product Form
- A monovalent human recombinant Fab (kappa light chain) selected from the HuCAL phage display library, expressed in E. coli The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
- Preparation
- StrepTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Pertuzumab
- Affinity
- Theintrinsic affinity of the monovalent form of Human anti Pertuzumab antibody, clone AbD35668 is KD = 14 nM as measured by real time, label free molecular interaction analysis on immobilized Pertuzumab.
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml.
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Perjeta is a trademark of Genentech, Inc. - Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin. - ELISA
- Human anti Pertuzumab antibody, clone AbD35668 can be used in an indirect ELISA or as capture antibody for Pertuzumab in a bridging ELISA.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Hispec Assay Diluent | BUF049A | E IY | 50 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Hispec Assay Diluent | ||||||
Human anti Pertuzumab | HCA342 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Pertuzumab | ||||||
Human anti Pertuzumab | HCA344 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Pertuzumab | ||||||
Human anti Pertuzumab | HCA345 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Pertuzumab | ||||||
LYNX Rapid HRP Antibody Conjugation Kit | LNK002P | CJ | 3 Conjugations For 400µg Antibody | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | LYNX Rapid HRP Antibody Conjugation Kit |
Further Reading
-
Capelan, M. et al. (2013) Pertuzumab: new hope for patients with HER2-positive breast cancer.
Ann Oncol. 24 (2): 273-282.
- Synonyms
- Perjeta
HCA341
![](/dist/pdf.png)
![](/dist/pdf.png)
If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up