Infliximab antibody | AbD17837
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 1](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image1-52w.jpg)
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 2](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image2-52w.jpg)
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 3](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image3-52w.jpg)
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 4](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image4-52w.jpg)
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 5](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image5-52w.jpg)
![Anti Infliximab Antibody, clone AbD17837 thumbnail image 6](https://images.bio-rad-antibodies.com/monoclonal/infliximab-antibody-abd17837-hca212-image6-52w.jpg)
Human anti Infliximab
- Product Type
- Monoclonal Antibody
- Clone
- AbD17837
- Isotype
- HuCAL Fab monovalent
- Specificity
- Infliximab
Human Anti-Infliximab, clone AbD17837, is an anti-idiotypic antibody that specifically recognizes the infliximab monoclonal antibody and inhibits the binding of infliximab to its target. It can be used in bioanalytical assays to measure the levels of infliximab and biosimilar products, such as Inflectra and Renflexis, in patient samples. Infliximab (branded as Remicade) is a chimeric monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of psoriasis, Crohn's disease, ankylosing spondylitis, psoriatic arthritis, rheumatoid arthritis, and ulcerative colitis. Infliximab is directed against Tumour Necrosis Factor Alpha (TNFα) and acts by blocking the binding of this cytokine to its receptors. Infliximab also induces apoptosis of TNFα expressing T-lymphocytes. View a summary of all Anti-Infliximab Antibodies. |
|
- Product Form
- HCA212G: A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- HCA212: A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- Preparation
- StrepTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Infliximab
- Affinity
- The monovalent intrinsic affinity of this antibody is KD = 3.2 nM as measured by real time, label-free molecular interaction analysis on immobilized infliximab.
- Approx. Protein Concentrations
- HCA212G: Antibody concentration 1.0 mg/ml
- HCA212: Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Remicade is a trademark of Janssen Biotech Inc. Inflectra is a trademark of Hospira, a Pfizer Company. RENFLEXIS is a trademark of Merck Sharp & Dohme Corp. - Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin. - ELISA
- This product may be used in an indirect ELISA or as a capture antibody in an Infliximab bridging ELISA together with HRP-conjugated HCA213 or HCA215 as the detection reagent.
Protocol: PK bridging ELISA to measure free drug.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Mouse anti V5-Tag:Biotin | MCA1360B | C E WB | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Mouse anti V5-Tag:Biotin | ||||||
Mouse anti V5-Tag:HRP | MCA1360P | E WB | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Mouse anti V5-Tag:HRP | ||||||
Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Mouse anti Strep-Tag Classic:HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Hispec Assay Diluent | BUF049A | E IY | 50 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Hispec Assay Diluent | ||||||
Human anti Infliximab | HCA213 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Infliximab | ||||||
Human anti Infliximab | HCA214 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Infliximab | ||||||
Human anti Infliximab | HCA215 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Infliximab | ||||||
Human anti Infliximab | HCA216 | E | 0.1 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Human anti Infliximab | ||||||
Mouse anti Human IgG (Fc) CH2 Domain:HRP | MCA647P | C * E | 0.2 mg |
|
Log in | ||
List Price | Your Price | ||||||
|
Log in | ||||||
Description | Mouse anti Human IgG (Fc) CH2 Domain:HRP | ||||||
Recombinant Human TNF Alpha | PHP051 | E FN WB | 50 µg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Recombinant Human TNF Alpha |
- Synonyms
- Remicade
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up